PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo5G0007600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 228aa    MW: 25602 Da    PI: 7.9224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo5G0007600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.9e-192471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++v  +G g+W+++++  g+ R++k+c++rw +yl
   Spipo5G0007600 24 RGLWSPEEDEKLIKYVSTHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 71
                     788*******************************************97 PP

2Myb_DNA-binding52.98.2e-1777120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ +E+ l+++++++lG++ W+ Ia++++ gRt++++k++w++
   Spipo5G0007600  77 RGNFSHQEESLIIELHRLLGNR-WAQIAKHLP-GRTDNEVKNFWNS 120
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-271674IPR009057Homeodomain-like
PROSITE profilePS5129419.581971IPR017930Myb domain
SuperFamilySSF466892.55E-3022118IPR009057Homeodomain-like
SMARTSM007173.7E-142373IPR001005SANT/Myb domain
PfamPF002491.7E-172471IPR001005SANT/Myb domain
CDDcd001677.27E-132771No hitNo description
PROSITE profilePS5129426.01972126IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2575127IPR009057Homeodomain-like
SMARTSM007172.0E-1676124IPR001005SANT/Myb domain
PfamPF002491.4E-1577120IPR001005SANT/Myb domain
CDDcd001675.75E-1279119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
GEKKKSGSAD MGHHSCCNKQ KVRRGLWSPE EDEKLIKYVS THGHGCWSSV PKLAGLQRCG  60
KSCRLRWINY LRPDLKRGNF SHQEESLIIE LHRLLGNRWA QIAKHLPGRT DNEVKNFWNS  120
TIKKKLISRA FDVLDIPSMV SPVPIAGDLH NVDAYPGELV GAAQEALFFL PHSDGSEMEI  180
KLDLPSHDVD LGTLPSFLQH QASSYDWPFS HQTTVTVNCH EVNGSTTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31241267108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009407596.11e-83PREDICTED: transcription repressor MYB6-like
SwissprotQ9SPG31e-71MYB26_ARATH; Transcription factor MYB26
TrEMBLM0TD231e-83M0TD23_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P35800_0014e-83(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128133035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.24e-76myb domain protein 26